SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002940304.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002940304.1.99540
Domain Number 1 Region: 150-257
Classification Level Classification E-value
Superfamily Immunoglobulin 2.29e-16
Family I set domains 0.041
Further Details:      
 
Domain Number 2 Region: 27-116
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-16
Family Growth factor receptor domain 0.0028
Further Details:      
 
Domain Number 3 Region: 104-149
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000263
Family Ovomucoid domain III-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002940304.1.99540
Sequence length 277
Comment PREDICTED: insulin-like growth factor-binding protein-like 1 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mqlfvvllplflcfqktpgvgafvslsacghcnedfcdsvtcaapelltkdecgccdrcl
svegevcggqdesrarcapgmvcvsrpsfgtgassfsdgtgvclceedgavcgsdgrtys
sacvlrlqswksqhqgtgsihkthdgeckfapliiasprkirnvtgsqvylscevkavpt
piitwkkvtespqgiklfeelpgdrinvavqvrggpsrhectgwvmispltkedegtyqc
hatnmvgetwadgsikvtehnarrikrrnhggsaskv
Download sequence
Identical sequences XP_002940304.1.99540 gi|301621946|gb|XP_002940304|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]