SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002941473.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002941473.1.99540
Domain Number - Region: 24-76
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00366
Family Thyroglobulin type-1 domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002941473.1.99540
Sequence length 197
Comment PREDICTED: transmembrane protein 140 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mfpsekfrkaagvlltislsglvcslliyallleagsiaisgckkigfynyclyngtsag
cycitdqegltavglncqkgllmslvltysslvtflmglltmalalsfnertlwmfpqvf
nglslaglsvgllmylcltwglydiselstgflalllaivglillssimrhysrltanpf
ktpttddisdqkynlvv
Download sequence
Identical sequences A0A1B8Y4M3
gi|301624359|gb|XP_002941472| gi|301624361|gb|XP_002941473| XP_002941473.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]