SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002941813.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002941813.1.99540
Domain Number 1 Region: 59-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000428
Family EGF-type module 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002941813.1.99540
Sequence length 170
Comment PREDICTED: probetacellulin isoform X1 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mdtltlskhlllplflgftvlpyvstdgnstehpettsppcpqytddctelssqskwngh
fsrcprtyrhycikgkcrfvtaesipacicdlgytgarceyldlfylkgdrrhyvvigli
vammfliilivgicicthhwqraqrrkrkekereglnndsatkveethfv
Download sequence
Identical sequences XP_002941813.1.99540 XP_017951885.1.99540 gi|301625229|gb|XP_002941813|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]