SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002943001.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002943001.1.99540
Domain Number 1 Region: 200-456
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.52e-79
Family Eukaryotic proteases 0.00022
Further Details:      
 
Domain Number 2 Region: 115-216
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.088
Further Details:      
 
Weak hits

Sequence:  XP_002943001.1.99540
Domain Number - Region: 63-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000812
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002943001.1.99540
Sequence length 460
Comment PREDICTED: transmembrane protease serine 2 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mdpiepnvygsiprtkkypdqeaatwctasnkkilcivsivcaliaaaiiiaalcwiyvp
igsncqkpcgangtsvlcsqwcdeksdcpngedeescgttgikvspndkscngttcvrly
gpnfqlqayspakatwlpvcydqwsdssgktacqdigysmstyysstpfsapsnngyfml
qsnnvtgklynnlqysatcasgnivslrcincglstkvdsrivggtpalvgdwpwqaqll
klvgtstylcggsiitpywivtaahcvygststpsifkvfagtlsiqsysssgrlveral
vhpnytsntqnydvallkltaglvfttnlrpvclpnvgmpwsggqpcwisgwgttssggs
iattlmaasvplissttcnqaavyggaisptmmcagylsggtdtcqgdsggplvtktnsl
wwlvgdtswgygcatankpgvygnvtvflewiylqmqtyp
Download sequence
Identical sequences XP_002943001.1.99540 gi|301627687|gb|XP_002943001|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]