SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002945612.1.37214 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002945612.1.37214
Domain Number 1 Region: 7-253
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.43e-41
Family N-type ATP pyrophosphatases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002945612.1.37214
Sequence length 402
Comment hypothetical protein VOLCADRAFT_55676, partial [Volvox carteri f. nagariensis]; AA=GCF_000143455.1; RF=representative genome; TAX=3068; STAX=3067; NAME=Volvox carteri f. nagariensis; strain=Eve; AL=Scaffold; RT=Major
Sequence
PGSRLNVAVLLSGGVDSSLALRLLRAAGHTCHAFYLQIWFQEDFRNFWGACPWEEDLQYA
RQVCESLGVPLEVVPLTTEYWDRVVSGSVEEIRAGRTPNPDMWCNSRVKFGAFYDYLDRT
YGAAFDRVASGHYARVERVPRRSSPAEVRLLLTPDAVKDQTYFLANLSPRQLSRVMFPLG
CLTKSQVRKLAAAADLANKNRKDSQGICFLGKVKFHEFVREHLGEWPGPILEAETGQPLG
LHQGYWFYTVGQRGGIKLPGGPWYVVAKDTLRNAVLVSRQYYDADKQRNTFTCGPFNWLD
AATRPDPDPRAGPLFVKVRHGPSMYCCELRLHDARGDGSYGNDSYGTVVLAQNDQGLAAG
QYAVFYQDGRCLGCAVIQETVDVGGAGRREKTGAPAAVSSKA
Download sequence
Identical sequences D8TGX3
jgi|Volca1|55676|e_gw1.1.522.1 XP_002945612.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]