SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002955715.1.37214 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002955715.1.37214
Domain Number 1 Region: 1-258
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.54e-74
Family ETFP subunits 0.000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002955715.1.37214
Sequence length 263
Comment hypothetical protein VOLCADRAFT_96652 [Volvox carteri f. nagariensis]; AA=GCF_000143455.1; RF=representative genome; TAX=3068; STAX=3067; NAME=Volvox carteri f. nagariensis; strain=Eve; AL=Scaffold; RT=Major
Sequence
MKVLVAIKRVIDYAVPVRVKPDKSGVEALIPKMSMNPFCEIALEEAVRLKEKGVAGEVVA
VSLGPQHFQETLRTALAMGADRAVHVSSEACGLSAQGGEQPQPLGVARVLAALAKRENAG
LVLLGKQAIDDDCNQTGQMVAGLLGWPQATFASKLEAAKGDPRVRVTREVDGGLEVLSLP
LPAVVSADLRLNTPRFVTLPAMMRAKKRPIESATLEQLGLSAADVAPQLRTVVVEEPPRR
KAGSRVADVGELVRRLREEARVL
Download sequence
Identical sequences D8UAP4
Vocar20006415m|PACid:23128420 jgi|Volca1|96652|fgenesh4_pg.C_scaffold_54000024 XP_002955715.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]