SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002957962.1.37214 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002957962.1.37214
Domain Number 1 Region: 199-273
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 118-193
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 3 Region: 291-360
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 4 Region: 458-491
Classification Level Classification E-value
Superfamily WW domain 0.00000000682
Family WW domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002957962.1.37214
Sequence length 494
Comment subunit of circadian RNA-binding protein [Volvox carteri f. nagariensis]; AA=GCF_000143455.1; RF=representative genome; TAX=3068; STAX=3067; NAME=Volvox carteri f. nagariensis; strain=Eve; AL=Scaffold; RT=Major
Sequence
MAEGQALSQLEAEHDDRNQEHGHDDSKREYSMGNDIPQAAAESSAADAIIDAGRIRALKL
ANFFAAQAEQAAGVLVESSKRKRDDCSVLEAPDLKRPAGDVVGLKLAADPTFAISAPLLA
MDGNATETIMCPPDKVGRIIGRAGATIRDLEASTSTRIQVDHKAPGDKPVVVSGRRDDVD
RAKRAVHDLISGATETTSPSTNEVQGTVECPPGIVGRIIGRGGETIRTLQQASGAHILVN
QDFPEGVPRQIIITGAQDAVQRATSMVSELINGSNHTNTQAIIQRFGVGSTEVVECPKAM
VGRIIGKGGETIKDLQKRFNVSIQIDQGSTPCKVTITGPSPLISSARRSIEELIRTPSQP
SGGGIRPGPSFTTSYTQPNYTPYGAYGGFAMPQAVYPAHSGYQPYGGYSPYPNTMPTYAS
YSSVGAASDPYASVGNYSQSHYTASVSQQNAGPTTPGAAGNSSLWQILQDDQGRNYYYNS
LTGVSQWEKPADVP
Download sequence
Identical sequences D8UH03
XP_002957962.1.37214 Vocar20005329m|PACid:23131799 jgi|Volca1|107877|estExt_fgenesh4_pg.C_820012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]