SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002964815.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002964815.1.77236
Domain Number 1 Region: 3-306
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.73e-31
Family G proteins 0.0005
Further Details:      
 
Domain Number 2 Region: 569-689
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000367
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002964815.1.77236
Sequence length 859
Comment hypothetical protein SELMODRAFT_439053 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MENLVSLAEAMQQASSVLLDDNDDSAQYTTFLNVVTIGNTGAGKSAVLNSIIGYTVMPTG
ENGATRAPIVVELERDQSEGKGLAVMTEGRARPSSANEIRLSLQSRISRIASSRSGRPEE
IRLRLRSSAAPPLTLIDLPGLASLDDQFVNEYGSHNDAVLLVVVPATSVRDITGSQALKM
ARELDPEFSRTVGVISKVDQSASDPKSLAAVQAVLSGQGPSASADITWVALIGQSVSIAA
AHAGSVGTDDSLETAWKAETETLRSILTAAPSTRLGRAALVDVISKQIRKRIRQRLPSLL
SGLEGRQQEVEGELVRLGEQMVETEEGTRALALELCREFEDKYILHINSGETGGWRVISS
FEGALPNKFKNLPLNDLFDLNYLKKVVLEADGYQPYLLSPEKGLRELVRRALELAKDPGK
HCVDEVHHVLVDIVAASASSTPGLGRYPPFKREVVAIASAALDEYRTHAKKMVVDLVDME
RSYIPPQHFNRLAQRRIDRLRREEETKTRVSKKAQDAEQVLLNKAAGPPVNQTPPLKSIK
GQSDKDKDSKDGKDGAPSSIAGGEISGVYLMKKSTNKSGWKKRWFVLNEKTNRKIMSMNL
QECAIDDASEKDDDDAPTTKSSKKERASDSSISLAFKITNKVPYKSVLKAHSSVVLKAES
IADKQEWIAKLRNCAQGTQQPPGKSASIVKEPSRAPEPVDTVIRRPADPDEDLRFMGQEV
RDYVEAVLNSLSANIPKIQELLQEAPDVKRRRDKCQRQSQVLNKLTHQLSMHEARVSTGS
GYTDTDGYGSPSSSKGAGEEWRVAFESASTAPPPSKSLSINGRIDRRLTATEENGDIGSS
RRSTPSRAAPAPPGSMYRG
Download sequence
Identical sequences D8R224
jgi|Selmo1|439053|estExt_fgenesh2_pg.C_50219 XP_002964815.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]