SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002966743.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002966743.1.77236
Domain Number 1 Region: 1993-2284
Classification Level Classification E-value
Superfamily BEACH domain 6.28e-124
Family BEACH domain 0.0000000141
Further Details:      
 
Domain Number 2 Region: 2406-2477,2506-2618,2649-2696
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.47e-29
Family WD40-repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 1881-1983
Classification Level Classification E-value
Superfamily PH domain-like 5.96e-21
Family PreBEACH PH-like domain 0.0032
Further Details:      
 
Domain Number 4 Region: 224-262,308-449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000317
Family Clostridium neurotoxins, the second last domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002966743.1.77236
Sequence length 2715
Comment hypothetical protein SELMODRAFT_60006, partial [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
SSLGSPLHSRGKAVLPDASPELMRLIDSAIQGADADQKSLHKLKRVVAGEESIEGGDGKV
DNDTRARLVVEILLAKMGGIEALDDTAAPKMMLSAGAAIVAGELIPWLSSEGDTGIFVSP
RTRIAKGITMTLQACTRNRAMCSAAGLLRVLLEAARILFARKAAAEEQGHEWDASPLLDA
IQALGSHCLTVVDLRHWLFTVTETGQSLDLVLALEKTMAGEETRGPAYTFEFDGESSGLL
GPGDSKWPFGNGYAFATWLYIESFADTLNTATTAAAIAVAAAAKTGKSSAMSAAAAASAL
AGEGTAHMPRLFSFLSADNQGVEAYFHGQFLVVESAVAKGKKSSLHFTYAFKPRRWYFVG
LEHIFKQSLIGKGDSEVKLYVDGRLYEARPFDFPRVSKPLAFCCIGTNPPPAMAGLQRRR
RQCPLFAEVGPIYIFKEPIGQDKMNRLAARGGDVVPTFGNGAGLPWLAISEESRALAEES
VALDIEIGPKIHLLYHPQLLIGRSCIDISPAGSSGLHRRPAEVLGHVHVASRVKPMEAVW
AMGEGGPLALLPLVVGSVNKETLQPNAGDITLSVRSSFLSGPILRILATALKYPGNADEM
TRGHAPELLAHLLGHLLVISSISKSVDGQERDEELVAAVVSLCQAPKGNATLEVQLYSSL
LLDLKLWSRCSYGLQKKLLSSLADMVFTEEKTMRAANAVQMLLDGCRSCYWIVPEPHSVH
SFAGGKNTRPLGEINALVDELLVIVELLTGSAQGPIAASDVRCLVQFVLDCPQPNQVARV
LHLLYRLVVQPNAARAATFADLLMKNGVVEMLLTLIQRESEIGENSEGLNLRELDEEEEG
EEFEEVPEGDITRTSSDSEAPVLSQKPVGHKNVGGITLSISADAARNNFRNVDKGDGMML
GIVGLLGALLVGGHLKSTIGNTVAGSGAVESPGLASWLLYALQRAFQVAPKRLLTRNVYS
AVLSVVGGMSSTDDGLAIFDTVHRFEHRQLFLSLLRALPSAPREIQLRALQDILLLACTH
ADNRTRLTAMPEWPEWLLEILIANYEVGSFDQPFNRLTSFQDLEELIYSFLTIILEHSMR
SKDGWMDIEAAIHCAEWLAIFGGPSMGEQRLRREESLPVIKRRLLGNLLDFAGRELQKQT
HAVAAAAAGVAAGGLSPRAAKVEAEAAAHLSMSLAENSLVLLMLVEDHLRLQHQAFNSGI
STGSLSVGSMSPRGQNVSSFMSFGRSSFDGGENLGSRRYSSGSDSGLPIEAFTSMADSNG
QVSVSAIERLTASAAAEPYESVRCAFASYGSCGVELAEGWKSRSRMWYGVGLPSKGTCGG
GGGGWESWSSALEKDANGEWVDFELVKKCIVMLKSLLLDDSGPGGSGGVGFGGGAGTGAG
GVHALNQLLDSDQPFYAMLRMVLLSMREEYTEEVQEESSYEQNFETHGSSVRTRSALLWC
VISPFLTMPLSEARRQRVLVAACIFYSEVWHAVSADRKILRRQYVEAILPPFTALLRRWR
PMLSGVHELTDADGLSPLTVEDRPLATDVVPSEAALAMISPSWAAAFASPPVSMALAMAA
AGVGGGEASAPKGFHVKREVANVERKFLRFRTFSGFQKSAPAEPPVIASPEPKDKAGAKA
AASAAARDQERAAKIGSGRGLGAVAMATSSQRRSSTDRERVQRWNLLDAMSAAWQEFFSL
GGESGQTKELKNKTLASLSAIVLTTKRLRSLEVERRLTVIASDAFRLGIGLRAWRSLLRR
LLEIEALFGPLLSQLNCPRTFWKLDPVENSLRMRKRLKINYKGSDHHGAAADYREPEETR
TRDSAPLPDSLLTAGAPALVPETTDEGTEDDLARSDVDDVDFKRENHSPSKQHEYEQMAA
STDFPLASPGHSIPVTPQSKERLLLEVSAVLVQPLKTGKGMFQVTTSHIYFVTDWNQDIV
DSCSLPGGTKVWHISSLKEVHSRRYLLRKSALELFMLDMSNHFFDFESADQKSQVYRALV
QARPPHLNTIYAATQRPERLLKRTQLMEQWANRQISNFEYLMRLNTLAGRTYNDITQYPV
FPWILSDYTSKKLNLDDPNVYRDLSKPVGALNPSRLEKIMERYHSFDDPVIPKFHYGSHY
SSSGTVLYYLTRIEPFATLAIQLQGGKFDHADRMFSDIGSTWNGVLEDMSDVKELVPELF
YMPEILTNDGGFDLGRTQLGEQIGNVKLPPWAGSPIDFVQKHRTALESEYVSAHLHEWID
LIFGYKQRGRDAVAAQNVFFYMTYEGSVDVDKITDPAIRKATQDQIAYFGQTPSQLLTIP
HIKRLPLHDVLHLQTIFRNPSSTVSYSIPSPERCNVPAAKLLAASDSIVTVDLNVPACHV
AMHRWQPNTPDGQGSPFLFQHSKSAAGSNGGSLMRMFRGQPVVGTEESHFPRVIALQAHG
IRSDAAVAISSNGRLLFTGGHADNSLKVVATNNARVIESAVGHSRPITCVGLSPDGRTMV
TGSQDATAIIWRVHSNSFASTSGSSDPSTMASGDLGTVDMKKRRVEGPLCVLRGHVDELS
VCCIDGSQDIVVSASPGRGVLLHSVAKGRFIRRLDIDRADILALSTEGIVVVWDRGSSRL
QTVTLNGIQVATRGFEGDVSSIVTSSDGRHIIVGFTSKKLHEQQGFELHHRPRVPDDEVP
DLTPKALPSISLLDIYTLQVIHTLRLQDGEDVTAMALNRDNTNLVASTANGQLLVFTDPA
LSIRVVDQMLRLGWE
Download sequence
Identical sequences D8R527
jgi|Selmo1|60006|gw1.7.750.1 XP_002966743.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]