SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002967619.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002967619.1.77236
Domain Number 1 Region: 170-375,404-441
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.49e-31
Family Phospholipase D 0.088
Further Details:      
 
Domain Number 2 Region: 467-606,653-759
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.59e-29
Family Phospholipase D 0.083
Further Details:      
 
Domain Number 3 Region: 7-154
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000113
Family PLC-like (P variant) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002967619.1.77236
Sequence length 810
Comment hypothetical protein SELMODRAFT_231070 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MASFLMHGILHATVFEAVGITDQTRVTGTAPEFLRMIVEGVEDVVGLGRGANRMYATVDL
DKTRVGRTRVVDFSPKSPVWNESFHIYCAHNVAHTIISVKADLRIGATVLGQAKVSVLNL
LSGQPLENWLDLCREGGKPIKGAKVRVRLQFFDVTKDPNFGFGVRDGFRFPGVPFTYFKQ
QRGCRVTLYQDAHMSDNFLPPIFLAGDQLYQPTRCWEDMFHAISNAKHLIYITGWSVFTE
ITMIRDPARASLGAEAQTLGQLLRRKAEEGVRVLLLVWDDRTSLSVVKTEGVMNTHDEET
FNYFKNTKVKCRLCPRNPDSGLSIVQGFQIGAMFTHHQKTLTVDVPAPGSHMRAITSFVG
GLDLAAGRYDNQHHSVFHTLNAAHKDDFRQTSFPRACRKFGGPREPWHDIHARIEGPAAW
DVLHNFEQRWRKQASKDANWLLELAQMRSIVPPTVPACPGEDWNTWNVQLFRSIDAAAVA
GFPQDPAAAGAMGLVSGKDNIIDRSVHDAFIAAIRRAKDFIYIENQYFLGSSFAWESHQN
AGAHHLVPREIALKIVSKIQAGQPFRVYIVIPMWPEGVPDSPQVMAILEMMVRSMEMMYR
TIAPALFAKQLFDVDLRDYLSFYCLGNRERRAPGDYLPVESPEPGSSYKLAQDHRRFMVY
VHSKMMIVDDEYIIVGSANINQRSMDGGRDTEIAMGAYQPYHTCLAQPPRGQVHGFRMSL
WYEHTGVLDNDFLAPSSIQCMRKMNSMGDYYWQLYAGEPEVDLPGHLLAYPITVAKDGTV
SELPGFSSFPDMKGRILGGRSDYFPDILTS
Download sequence
Identical sequences D8R9X4
jgi|Selmo1|231070|fgenesh1_pm.C_scaffold_9000013 XP_002967619.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]