SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002967688.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002967688.1.77236
Domain Number 1 Region: 23-123
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-30
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002967688.1.77236
Sequence length 137
Comment hypothetical protein SELMODRAFT_169402 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MAGIAGFFTRKEPAEENQVPFWSNPERAGWLMKQGEYIKTWRRRWFVLKQGRLFWFKEST
ITQYSRPRGVILVSGCLTVKGAEDVLNRQHAFELSTNKETMYFIADSDKEKEDWINSIGR
SIVRHSRSITETEVLDY
Download sequence
Identical sequences D8RAA6
jgi|Selmo1|169402|estExt_Genewise1Plus.C_90576 XP_002967688.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]