SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002968930.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002968930.1.77236
Domain Number 1 Region: 54-210
Classification Level Classification E-value
Superfamily IpsF-like 1.44e-57
Family IpsF-like 0.00000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002968930.1.77236
Sequence length 211
Comment hypothetical protein SELMODRAFT_90975 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MFYDGVESFARSPSRVELSRRVSRAARGTICCASTTTVEVETGRTASISAPVLPFRVGHG
FDLHRLEPGLPLTIGGIDIPHDRGCEAHSDGDVLLHCVVDAILGALSLPDIGQLFPDTDP
RWRGAASSVFVKEAVKRMHEAGYELGNLDATLILQRPKLSPHKEEIRANLCSLLGVHPSV
INIKAKTHEKVDSLGENRSIAAHTVVLLMRR
Download sequence
Identical sequences D8RDL1
XP_002968930.1.77236 XP_002989977.1.77236 jgi|Selmo1|130637|e_gw1.102.144.1 jgi|Selmo1|90975|e_gw1.11.257.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]