SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002969532.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002969532.1.77236
Domain Number 1 Region: 13-135
Classification Level Classification E-value
Superfamily PH domain-like 4.06e-47
Family Necap1 N-terminal domain-like 0.0000579
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002969532.1.77236
Sequence length 250
Comment hypothetical protein SELMODRAFT_91405 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MVEGEEEDVDPEATTLLVVREVSVYKIPPRTTSAGYKCGEWLQSDKIWSGRLRLVSTGGK
CEVRLEDSNTGELFAACPVEAGKRDATVESVLDSSRYFVLKVDDGRGRHAFLGLGFSERS
DAFDFNVALSDFDKHAARRGGGEQHSQHSPSDTSLDLRLKEGETIKINVKTRTAQSGGIK
NATSSSMASTGRMAAPLAPPPGGGRIRSPLPPPPSPANDTKIKLHQSPALPPDPLADLSQ
LQVSVFALKL
Download sequence
Identical sequences D8RE88
XP_002969532.1.77236 XP_002986754.1.77236 jgi|Selmo1|124794|e_gw1.76.200.1 jgi|Selmo1|91405|e_gw1.12.843.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]