SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002973500.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002973500.1.77236
Domain Number 1 Region: 118-201
Classification Level Classification E-value
Superfamily PH domain-like 0.00000902
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002973500.1.77236
Sequence length 432
Comment hypothetical protein SELMODRAFT_413905 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MNTQKELWKRSEVVHALNRSSRRTEDSKLWAFCDFLRHGIRAVACDGILRLAIREKFQKL
WKAKVKHHVNYAHLAATSGSPDMARCQELTRLSGSTSGEATSHDHLKWQGTRHFSAAAAQ
LGSTDEEIQYSGWVEKINNKGAVQPRVMVVSNLAVYNFKSRLTVQCKRRIDICAVVHIVR
SKYSHQFILCCPQEYDYLFSSIQVEEICDIIVAVHKAATGNTISVEYKVEVDLSEFVLTR
QEAKKIRKEHPELALKNSAEDPVQVKTKTNNVAQPSTMTQMKANGMSWSVEDATPSSKLL
PENHPPSAALKDVVVLGHDVGGDSTDDLKVFKVIDELYVMKNKKTGETFALKPVESQSQT
RQPRCTLSAHVNGDDRKGNLVGDQFDITSPATKKEIQAADKNELPPALRRKERTKKKKKV
KAYPVLGMTKRR
Download sequence
Identical sequences D8RR04
XP_002973500.1.77236 jgi|Selmo1|413905|fgenesh2_pg.C_scaffold_22000032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]