SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002977913.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002977913.1.77236
Domain Number 1 Region: 13-120
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-18
Family Pleckstrin-homology domain (PH domain) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002977913.1.77236
Sequence length 359
Comment hypothetical protein SELMODRAFT_107863, partial [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
SKSSLEKIKKQLSAGSGNSALQGPLFKRSETLRKWNQRWFTLDPATGKMEYRLDRGDLSS
RGQIYFDADSTITLSPINFHGAKKYDGCCFYIGTPHKKEYYLCAESQAVARAWVATLRAS
SLVLKAHKEAVNSLSGNGAAKLGTVAAVVTAANTVAKEAAKDIASEMQTSIKATLSGKSS
QTASGDGGMDNVSIMKETLRVKDEELHQLSRELRTRDVTIKELADRLSETADAAEAAARA
AHAMDKERKAARAEADRALKELDDRTKVARLQLKAGEERYAAVMRERDEALVEAQRWQKE
LAKAREQMLLMEAARIRQGAAASDAAAAASAAAAGEQKVSKEKMISEGFSHARYQSSSF
Download sequence
Identical sequences D8S3F0
jgi|Selmo1|107863|e_gw1.35.546.1 XP_002977913.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]