SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002978533.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002978533.1.77236
Domain Number - Region: 364-472
Classification Level Classification E-value
Superfamily PH domain-like 0.032
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002978533.1.77236
Sequence length 494
Comment hypothetical protein SELMODRAFT_443866 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MKSSPERIQGSGFHHSFASKSSDFKGSFLHLENIQEDSAVSFPSPTPGFPEPETPQEPLE
FLSRSWSISAFEVSKARAASQTSIATPPPPPLQDDCSTTISSPQESNLEGAPFVFAPSMT
SQMVMDRIMEHSLFTTPRRNSHSSGPLIFHQNSGILAASPPPSPKQFTDDHLHPHHQPTA
ASKSSHQLRGRSSVGRWFKDMKERKKELSRAHNAQVHAAVSMAGVAAAVAAVAAATAAAA
SPSPSPFSPALDDPSSSSKTTSLAVASAASLVAAQCVDLAESLGADHDHITHVVSSAVNV
KTAGDIMTLTAAAATALRGAATLKARTLKDAKSHATVTPYDKHALHFNSGDLGSEDGDAE
SYTQEVLNRGCEFLKRSKKGELHWRTVSVYSDPNNGQVIVKIQSKHMGLRKKRKGIVLDV
DANIPAWPGRSLLDNGEQRRYFGLKTATGMLEFECKSEYEHRLWTQGIAHLLHLSSQQSV
ALTTTSTQSSTKRP
Download sequence
Identical sequences D8S512
XP_002978533.1.77236 jgi|Selmo1|443866|estExt_fgenesh2_pg.C_370102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]