SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002980735.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002980735.1.77236
Domain Number 1 Region: 75-190
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.62e-20
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002980735.1.77236
Sequence length 197
Comment hypothetical protein SELMODRAFT_420273 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MCLLPTSERGKSRTMKHLPELCSSRRWRRLYALRTHELASPRDRECFTARRRLVVSSYCV
FKACPTGQTLACPPLRTIPQVVMIHGESNVSQLQSVMLLVYPTGVRVVVHTANLINIDWN
NKNQGLWMQDFPFKSMTGASDFENDLVDYLTALEWLGCTVDVQHHGKMKINVGHFQNFDF
SNAAVRLVASYLAISAE
Download sequence
Identical sequences D8SBG9
jgi|Selmo1|420273|fgenesh2_pg.C_scaffold_45000182 XP_002980735.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]