SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002982989.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002982989.1.77236
Domain Number 1 Region: 248-379
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-27
Family Ran-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002982989.1.77236
Sequence length 484
Comment hypothetical protein SELMODRAFT_445374 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MADASNKKRGALRQITKDDRADDDEEDASPSEQGTFARASDEVLATRKIVKVRRSSSTAA
APSGPNLFANIQLVAPSTAPPVVSSTPAPAPVMDSPVKDPGENAKDGGKNANGNGNAKEE
EEKQAKEEVAPNENGEEEGGNPGKAPVAAALPKSFDQVSSSANAFGSFGTAFSTSSFSFS
TTGSSFSFGSSPAMGFGFFGSSTTTTTTATPAEGGKFPLFGQAPPSSGDTAAPPSSSGGG
GGGGGGHPTVSLQEVPVETGEENEKAAFSGDGILYEFVDKSWKERGKGELKLNLSEDLKK
ARLVMRSRGNLKLLLNASLFPDMRMSKMDGRSVTFACVNSAAAAASAAKDGKAVLTTYAV
KLRDAAGIPEFLGLVEAHKGIRPAAEVAEAAEEAEEVAAVEQKADDQSGSEDAQRNGGEE
QAPKEEQTNRKNKVIATMSTMSATTLLSLPSVIPALVVGLALELERDPAHRQGGRDYTTC
ELAS
Download sequence
Identical sequences D8SI35
jgi|Selmo1|445374|estExt_fgenesh2_pg.C_560060 XP_002982989.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]