SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002983671.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002983671.1.77236
Domain Number 1 Region: 326-699
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.48e-118
Family Oxysterol-binding protein 0.0003
Further Details:      
 
Domain Number 2 Region: 10-50,86-143
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-17
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002983671.1.77236
Sequence length 707
Comment hypothetical protein SELMODRAFT_234344 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MIEGRSSAANPNVAGVLHKWVNFGKRWRSRWFVLHDGVLSYYKVHGPDKLYVNQELQKGV
RVIGDEAQKLMRKPRKHWNEKRPRKTSGDVHLMVASIRKSKSDDKKFYIFTGTNSLHLRA
ESRDDRATWLEALQAGKDLLPKIICLQPHEEDSISTDGLRKRLIEAGVSQGVIKDCENII
LTEFREKVTPLQQRYLFLMNRLNQLEVAEKVELETTVVEESRSHEDQPQERDHGSESDSE
EDNGKMLDAETDDDDDLYFDTAESLSGSFRSPSFLHRQLSADPLDGGDSPVLSTPRAVLP
DPAMELFSQDYPIVNRRKKLPDPKEKEKGFSLWSIIKDNIGKDLTKVCLPVYFNEPISSL
QKCFEDLEYSYLLDRAAVCGQMGNSLLRILYVAAFAVSGYASTDGRICKPFNPLLGETYE
ADYPDKGVKFFSEKVSHHPMVVACHCEGRGWKLWGDSNLKSKFWGRSIQLDPVGILTLEF
DDGEVFQWSKVTTSIYNLILGKLYCDHYGTMRIQGNRDMSCKLKFKELSIIDRNPHQIHG
FVYNKANKKLATLFGKWDGSMYYVNGDLATKPRGYDPMCEAELLWARNLPSDYPTRYNLS
SFAITVNELTPGLEEKLPPTDSRLRPDQRHLENGEYEQANSEKLRLEGKQRRARKLQERG
WQPRWFHKDIGSSTFKYIGGYWEARSQGDWSNCPDIFGQSLPDDGSD
Download sequence
Identical sequences D8SK53
XP_002983671.1.77236 jgi|Selmo1|234344|fgenesh1_pm.C_scaffold_59000041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]