SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002989600.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002989600.1.77236
Domain Number - Region: 401-443,513-584
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00942
Family BAR domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002989600.1.77236
Sequence length 734
Comment hypothetical protein SELMODRAFT_428168 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MGCAASKVSKAEDVSRCRARRRLMKQTVASRHHFAATHAAYIQAMKNVGAAFRQFGETEL
RDAQAAAAERTKSSSLQSPDRPLPPPPPPVFLQDSPRMEFLSPPASPIKTEDHESEEAKD
QERRQRKREQEQQQSRFQKLEQEHEGFYYHRGDDKDDKGAYYFTAPPPPPVPSSTAPPPP
SPPRDSAWEFLDPFRPQEHPVLLHDQRTSKKVENPSVIGSSKRDLAIILLPSGGIGRKDL
LDVVKEVDELFLRAYECGKDVSKLLEARKVHYHSNFVDSRGHESHSKRVLQAISLGHRGS
SKTPLKVVASEDHLSSPEDSGKAGSHAGTLDSLLAWEKKLYEEVKNTEVIRAEYRKKCSP
KLQEEMSDATRSMIKTLSTKIQVSLQGVDTAISAINKLKEDELHTQLVQLIEGLMNMWNE
LYDCHQRQHKIASDMKSLDHWGTVEPTTNIHRLATSQLELALGAWLAGFNKLISAQRDYL
HNLTGWLRLSNMQLELESARETPGSKKKQATARPAWLASMLQLCLDWSLALDRLPDKVAS
ESIKSFEAVVHKLVDLQNEEVKHRKKLDAVSKEFDKKMARLSASTKHRKASREEQQQQAT
DTRKEKDPDKEKAAAENDPPGSAEATNEDSNLVESIPSILRAAANRGSGKSRRRGSPEER
MRQAVNSIQAKLEEEKERVAKVVFDTRATTINSLHTGLPSIFQAVAGFGRISLHAYQSLY
CQAHNGALLRITQA
Download sequence
Identical sequences D8T1Z2
XP_002989600.1.77236 jgi|Selmo1|428168|fgenesh2_pg.C_scaffold_99000018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]