SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002991915.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002991915.1.77236
Domain Number 1 Region: 14-115
Classification Level Classification E-value
Superfamily PH domain-like 2.35e-26
Family Pleckstrin-homology domain (PH domain) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002991915.1.77236
Sequence length 253
Comment hypothetical protein SELMODRAFT_430200, partial [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MADLARNGAVERDIEQGAQLLKYGRRGKPKFCPFRLSNDETHLIWYSGKEEKSLRLSSIT
RIVPGQRTANFQRYPRLEKEYQSFSLIYGNDRSLDLICKDKDEAEVWFVGLKALVSGGQL
SRLRFDSRSECGPPSDSNSPATWSRISPASSPFGNVDNLPRQDGREAFRFQSPYGSPPRY
ALQQRSFSPGAPSLDSSSKLFLENASTAGSLHSDMSSEPAASVLHLRGGAAAATSAAAAI
PLDANFRVSMSSA
Download sequence
Identical sequences D8T8N6
jgi|Selmo1|430200|fgenesh2_pg.C_scaffold_125000079 XP_002991915.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]