SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002993298.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002993298.1.77236
Domain Number 1 Region: 26-305
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.09e-31
Family G proteins 0.00048
Further Details:      
 
Domain Number 2 Region: 556-680
Classification Level Classification E-value
Superfamily PH domain-like 8.31e-18
Family Pleckstrin-homology domain (PH domain) 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002993298.1.77236
Sequence length 894
Comment hypothetical protein SELMODRAFT_449094 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MENLRVLAESMQQASALLSDQEGEESLDQYSSFLSVVALGNTGAGKSAVLNSLIGYAVLP
TGENGATRAPVTIDLEADDSGNKRGLTVQMEGKSMQVSATDIRHSLQNKFGRMSTGAVKE
NIHLKLKCSSAPPLKLVDLPGLESRSVSDSLVREYIDSNDALLLVVIPATSVRDITGSQA
LKIAQDIDHEGSRTVGVISKIDQAASDPKSLAAVQAVLSGQGPSITSKFTWIALIGQSVS
IAGAHSKDDSLETAWKAEMESLKSILGGASSSRLGRSSLVEAIAKQIRQRMQQRLPSLLS
SLEGRSQDVEEELVRLGEKMVETEEGTRAVALELCREFEDKFLEHINSGEGGSYKVVTSF
EGTLPNRIKQLPLQELFDLNGLKKVVLEADGYLPYLLSPEKGLRELIRRALDLAKDPAKS
CVDEVHRVLVEIVSSAASATPGLGRFPPLKREMISVASSALDEYRTEAKRMVVDLVDMER
AYIPPQHFTRLVQRRLDRVRREDEVKNKTMKKAQEAEQAILNKSTYNPAAQANGSLKSAK
DGDGKDVPESSGAEKDKTGYLSKRSATSADTWNKRWFVLNEKSNKLGYMKKPDDKRFQGV
INLEECLIEELSEEELAEGRPSKSKEASKQANGPEPNLTIKISNKVAYKTVLKAQHVVAL
KAESMAEKTEWMTKLRQCTDQGKGSSKAVVEVVTPLRTSMSDGALDTVITRRADPEEELR
IMAQEVRDYVEAVMNSLSANIPKAAIFCQVERSKDSMLSTLYKSISALPTPTIKELLQED
AQVKRRRERCERQASVLSRLVRQLSNNEARVTMSNGYIEGTQNGYHGGDDWRVAFEEAAN
SPSPRTPSGFSSSSRRSLTPHRGEALENGDSSRRTPTRRPPPPVPGIGAPTYRQ
Download sequence
Identical sequences D8TCK1
jgi|Selmo1|449094|estExt_fgenesh2_pg.C_1520028 XP_002993298.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]