SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002994725.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002994725.1.77236
Domain Number 1 Region: 1018-1061,1130-1182
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-18
Family PreBEACH PH-like domain 0.052
Further Details:      
 
Domain Number 2 Region: 1210-1233
Classification Level Classification E-value
Superfamily BEACH domain 0.0000432
Family BEACH domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002994725.1.77236
Sequence length 1235
Comment hypothetical protein SELMODRAFT_432626 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MGLQVIVRNVLLEMLIDLQMTINAEDVLETWHKTVSSRIITFVLDEAAHPTTMRWIMTLL
GVCISSSPTFSIKFRASGGYQAISHVLSSFYDAPEIYYILFCLMFGKPVYPRQPEVRLLD
FHALMPGEAIEGEILFTEFLDSILLMFKAAFDKMSLQSQIVQQTGDFSQFPESLAAGFAN
GFKDIGGDLQSEALLHKTYAARLMGGEAAAPSLVTSLLRSAAAIEAAQGISAEANNQSSY
KFSDDFQVINQKVGAKADAEEPAAQEVELLAVSTKSSPIDIMKPFQADESIDNFFVFPST
YAENTTNGDDTHSQRSSSFSNAFTESSTSAFVTLPLSPTTSDNSRNEAGTPLPSRTPGNN
LASWVKSTFPSDTPAPSRSASSIPSRTTSIVSASTHGPASDSDRSSIQDDKQAFPITKKL
LLQLESAGSGGGPCSSGATAVLDLVAEVLADALADQLKATPLVEATLEAVPLHIGGDIAV
VFQGLCLYRVMNFLERRLQRDDEEAHKKLDRARWSSNLDAFSSLVVDRVYMGAFSDSAGV
LKVLEFLLSMLQLANKHGRVEEAMTTGRSLLSLARGGFKQLEPFVQSLLRNTNRMLLFCF
LPSPTTNEELTSSNTGLLAKGGLDITLVLQLLISHKKLVLCPGNVDSEFLQCLLVNIVPL
LQDPRQAVRTLAVDACKVLLHYRKEALEDILVLRHASGEALDVFHGGFDKLLASNSIGFY
TWFDDAHDAIGRVLEQRASLAWMQFIGGAARFNSSRLKNFEVRRKREMGRRMKDASKADG
RHWEQMLERRVALDMVRDSLSAELRLMRQVKYGWVIHAENEWQDHIQQLMHERGLWPVVK
SVAESDNEWQLCSTEGPYRMRKKLVRCKPKIDIAAHAPEEAEAEVLPNGQAGFAVDIENP
DYDSFFHIFSLGVDSPKKNAAKDYLESFDEEDTESKGREDDANSLSTRGDGTIERSRSAI
NDSGKSPESIQRSKSDAHGTAPGSSPTKTGDFQLDDADDQDFQDDGEYLIAPYLERGEKI
RFRYNCERVAGLDKHDGIFLIGERCLYIIENYFIDSAGRICEKGGEGELSVIDQALGVKT
SISVVFESTQTATWSDTENTWPGGKAWACSGGAWGKEKLSSGRQMPHSWRMWKLDSVHEL
LKRWYQLRPVAIELFSMDGCNDLLVFHKEERDEVFKNLLSINLPRSSRLETAISGVSKLD
SNEGGRLFKTMAKSFSKRWQNGEISNFQYLMHLIR
Download sequence
Identical sequences D8TGK6
XP_002994725.1.77236 jgi|Selmo1|432626|fgenesh2_pg.C_scaffold_581000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]