SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002998701.1.21288 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002998701.1.21288
Domain Number 1 Region: 9-171
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.7e-22
Family Ypt/Rab-GAP domain of gyp1p 0.0033
Further Details:      
 
Domain Number 2 Region: 150-236
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000366
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002998701.1.21288
Sequence length 343
Comment conserved hypothetical protein [Phytophthora infestans T30-4]; AA=GCF_000142945.1; RF=representative genome; TAX=403677; STAX=4787; NAME=Phytophthora infestans T30-4; strain=T30-4; AL=Scaffold; RT=Major
Sequence
MVSDWFETSGARKLRDASAHSYQEHLRHSESCVSPLFEEDARQIELDLPRTGESIRLFLL
SHSEREAFQEDEELPQHVMQRFLPQLKNILVAYSMRNPRVGYVQGHADVLCFLFGNVNER
RDEEETFWVYASVIERVFPEDFFARTPKLHGFQVDCKLYNELVVRKLVPLYPILAKIDLP
LVTTLLSCKWFVSLWVGELPLPLLYEVWDTMLREDDGTILHLLVALHFFRLAVDEIQLHM
EMEQWDSSYIYKIILGQCQNATEIAPQTLLQQAQTLYGFKDESVEDMRAAIRRLPQLRKA
ELTVLAKQTHFSRLEMERLQDEFTFLRYQRKTCGRSKLRGLTQ
Download sequence
Identical sequences D0N596
PITG_06614 XP_002998701.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]