SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003002367.1.67963 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003002367.1.67963
Domain Number 1 Region: 97-237
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-47
Family Ran-binding domain 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003002367.1.67963
Sequence length 257
Comment ran-specific GTPase-activating protein [Verticillium alfalfae VaMs.102]; AA=GCF_000150825.1; RF=representative genome; TAX=526221; STAX=1051613; NAME=Verticillium alfalfae VaMs.102; strain=VaMs.102; AL=Scaffold; RT=Major
Sequence
MSAPEATEPKVEEPKIEAPKAEEAPATGTADAPATESTGEADKPVTAQSSVFSMFGGGAK
KEKKPEDEDRGDNSGSNKAQREAAAAAADDDQAPESEDVHFEPVHKLTEKVETATNEESE
QQLFKMRAKLFKFIKESSEWKERGTGDVRLLKHKENGKTRLVMRRDKTLKVCANHYIVPE
MKLSPNVGSDRSWVWNAAADVSEGEPEAATLAIRFANSENANLFKDAFLQAQKDNEALFK
KAEDGEASTETPAAEQS
Download sequence
Identical sequences C9SSF1
XP_003002367.1.67963 VDBG_07826T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]