SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003004979.1.67963 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003004979.1.67963
Domain Number 1 Region: 281-520,625-640
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.72e-59
Family BAR domain 0.014
Further Details:      
 
Domain Number 2 Region: 814-931
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.79e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.00028
Further Details:      
 
Domain Number 3 Region: 630-753
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-21
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003004979.1.67963
Sequence length 1092
Comment csx2 [Verticillium alfalfae VaMs.102]; AA=GCF_000150825.1; RF=representative genome; TAX=526221; STAX=1051613; NAME=Verticillium alfalfae VaMs.102; strain=VaMs.102; AL=Scaffold; RT=Major
Sequence
MGIVSSRPDDGASLYLRDQNRLSISSIVVTNPRTRNTVNIAPNAFPASRIVASRPAGEST
PIEFVQDLESAVPGGAPNFILKLSSDEELVFTFTFVIRQSEAGVAQPTNGVAEVHPPVDT
QITGLTYVYASSPREVENLVTREFHADPNLHKNANVELVGDFTTGGSPSVAFDWTWKWKP
PKNTEDRGGGWRNSCSFSYWVSNTTTPLSTPTLISAFSPGAASQARVASSQSVESRISHA
DLEEPASPLYSVPTTIQTPLPHQLPPQPEPVKVDVVCPKPGDDMTVTDDGPVFRATIKAL
EQKTGNMRMQVKRVLKKAESAYEAQTDANDKFASFLEALKEASATNANAVQPAIDHYFDK
IAQEIMAYERRNTLNLQKIVIEPLSKVYTFDIKRAEDKKRDFEEESKDYYAYLARYLGQR
HDSVKAKKLAESDTKYQTKRRTFELKRFDYSSFMQDLHGGRKEQEVLSHLTRYADAQARG
FLGAARKIDTLLPQLEALSNEVSEADKEFQYQRREREEKRRLLEKSNADTDLPPAAANNA
YSTSSNGQATSTSDSELGRADSTGSQLKSAISGGSQGAVASPELSRSPGSLGQSSIGSPA
AASKFKGIRDLEERDHVQIANAERHNAQRKEGLLWALSRPTSHVDPRNLNKPGWHKFWIV
LDQGKLSEYSNWKQRLDLHMDPIDLRMASVREARNAERRFCFEVITPHNKRVYQATSEED
MNSWILSINNALQSAVEGRMGDRSGPAPSSSDSSSFKRDIGSILTGKSPSLGHGSYNPNA
NSNSGMPARRITVGAKPSIPRAPSGSYDDTPDKLLQMLRDNDQGNCWCSDCGSGAKVEWV
SINLAIILCIECSGIHRSLGTHISKVRSLTLDITSFTADIVELLMLVGNRVANMIWEAKL
DASIKPGPQATREQRLRFITAKYVDRAYVEPISTTLSRYSTPDETLLAGIKKNEVQQVIY
AMALKANPNATDKSRGTHAVFLALAAADPASPSAVGGQQPEPEKPVPFPVAEMLVQNGAE
IPTTMPAFPLSRSAQLYVEQKRGRSVGISRDGIGSLRPSQNAGDKIQQDMESRLHKRMSA
GGRLAKSPIPER
Download sequence
Identical sequences C9SHQ3
XP_003004979.1.67963 VDBG_04585T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]