SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003006326.1.67963 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003006326.1.67963
Domain Number 1 Region: 664-725,760-806
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-17
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 2 Region: 16-79
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000236
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 3 Region: 235-311
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000923
Family SAM (sterile alpha motif) domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003006326.1.67963
Sequence length 907
Comment conserved hypothetical protein [Verticillium alfalfae VaMs.102]; AA=GCF_000150825.1; RF=representative genome; TAX=526221; STAX=1051613; NAME=Verticillium alfalfae VaMs.102; strain=VaMs.102; AL=Scaffold; RT=Major
Sequence
MAARPQNEGHPKPDAGDTLLVIHDFLARSSDELSLVKGDRVELIERDDEFGDGWFLGKHL
ANGNSGLFPEVYTRPAPKIQHANAPLNHVPSAKAIESPAEPSQNIGSSNTVDPAQSVSVP
ATPPVASPSSTDAATPVTLPLNAAKKDDVPSQPQPSISGPSFGSLSSLEAGPDSHVLHET
LNVIDEHITDLRSPPSSSGLRAATNDSGSEYSTQLDHRLSYIQGEETDEEEEGAHSRLEV
EAWSPDQVAEHLFTAGVEKHHCEVFRDQEITGDVLLGMDQSSLFIKAFDLGSVGRRLKTW
QKIKALQDECNGQGIATKRTTQTYGSDAGSDGRRTRSRTSTMTNSMHRLPPGDDRTMSIQ
TRRLSITQTPRMEAAGLVSPISSTKQPSFDRNWSLGNAFSSPRPLSSAGLQDAMHQSGLS
VQETAPDLDRGYFSGNEVDGRRRNVLRKRDSGAHSKKNSYADEQRVRSATAISRHSRYGS
IDAPREGAPSAAAQKYYGLQSGPHKRATSTSTTRSIPRVPSIREVPSPVVTKLDSASRDL
PLVSGSPANRQNVNSDWLASLVNKPTVKIGGLRATSDISSGERVRITSPVDTTVKDSPLP
SPAPTGSSTPSAGPSFDLESPGNGKMSPSTTTTAASKNSRRKGKKETSAYQRGLQKIGPK
EAMKDADYSGWMKKKSSNLMTTWKPRLFVLKGRRLAYFYSENDQQEKGLIDISFHRVLPA
DNEKLTGLHATLTGAGSAAAPAASTLAQPEVALDKGDDSMFIFKLVPPRTGLTRAVNFTK
PTVHYFAVPNLQQGRLWMAALVKATIDRDDTQPITTTYQQKTISLAKARAMRHRPPALMN
LDETPEEDKKNVGVSNKDANLLGIHFGETDSGVSGLEKPGPQKVESANAQKLFFDAESSA
TPPPQSA
Download sequence
Identical sequences C9SGS6
XP_003006326.1.67963 VDBG_04279T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]