SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003009086.1.67963 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003009086.1.67963
Domain Number 1 Region: 330-381,411-470
Classification Level Classification E-value
Superfamily PH domain-like 5.33e-18
Family Ran-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003009086.1.67963
Sequence length 491
Comment conserved hypothetical protein [Verticillium alfalfae VaMs.102]; AA=GCF_000150825.1; RF=representative genome; TAX=526221; STAX=1051613; NAME=Verticillium alfalfae VaMs.102; strain=VaMs.102; AL=Scaffold; RT=Major
Sequence
MADEPQSGSPRSDPVDSKEDAETAAARKELRHAAISENTVADSVGQTGRTTPEDDQEDDL
KDRISSPKKKRARDQLDDVEAEELDTHSVASTDSAKDRALRSEPEKKRHRDEVADETVKT
TADAEKGSDTVENEATTEKATVDVSDQKDPKTKTLPVSEKEKTTSSSAFASSGFAKLASS
SASPFGALGGGSAKKSVFGGSAAAASPFASASPQKPATTAATPTLSFGSTGEPAAASPFA
SAAPGANGFKSVFGGGGGFGSALAGNPLTSFAKPGASFKSEKPAKPFGAPESDAEDEDGD
EDGDEEPESAADDKDAKEDSDKEDAKVSEEKKKSRLQRVAVDDGEAGEITVLAVRSKIYH
LVKEEGWKERGAGMLKINVPESCVSFDDDGVPIPGSFDASGLEDDEEAAAGSKTVRLVMR
QDSTHRILLNTTVFPALDFQEKASLKAVGVCFTAFEGEDAKPVTVQAKMSIANAKNFMSE
IGLIQRELASA
Download sequence
Identical sequences C9S775
XP_003009086.1.67963 VDBG_00768T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]