SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003035059.1.72525 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003035059.1.72525
Domain Number 1 Region: 194-284
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000021
Family Thioltransferase 0.036
Further Details:      
 
Domain Number 2 Region: 385-458
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000194
Family UBX domain 0.074
Further Details:      
 
Weak hits

Sequence:  XP_003035059.1.72525
Domain Number - Region: 4-49
Classification Level Classification E-value
Superfamily UBA-like 0.000209
Family TAP-C domain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003035059.1.72525
Sequence length 594
Comment hypothetical protein SCHCODRAFT_105420, partial [Schizophyllum commune H4-8]; AA=GCF_000143185.1; RF=representative genome; TAX=578458; STAX=5334; NAME=Schizophyllum commune H4-8; strain=H4-8; AL=Scaffold; RT=Major
Sequence
MSSPSRQAEAIAQLTEVTGGSCTDEAARDMLESVDWDVQRAAELIFDGAAPPPRRPAPMQ
QFEVEDPPYATQKASPAPSSAIARALVFPFRILLYPLRALAAILLPRPAYAALASTLARL
SPAAIFLGVSHLLFGPPTPRRDLLRQLEEDTGAIPYSRWLSGGDNATTTGAEAGPGPTTA
QRRGARSQPPSGAVLPDFQPVPYDALLAQALTEARVACIILISSEHDDVPAFIRSTLTDP
AFVKALHDNNVLTWIGDARMRDGWQAAQKLNVTTYPSVLFLAPQPAARGAPTLRILSRHA
GAAATTPTALTTYLTTTLIPRVSTYLEQLRTNPASAGQPAAHAELAAARRIRAEQDAAFA
ASAARDRERIVNAMNAEREAAERAQAEAAAAAAAEEEARRQTAERAAWRAWSRREVAARS
PGGGLRVAFRLPSGARAVQTFDAKDTLTGLFSYIDAQLLEEDGAQASSASAASLPLPSTR
EEAEKAFDAYLATHPTHFRFTMAVAYPRAPIAWAPGVALGDVRELAGGAQIVVERVSEKR
SGRASGETSRASLAGGQASAAGSRVSLDASRNGTPVNGASNADDDEYLTESDEE
Download sequence
Identical sequences D8PW55
jgi|Schco1|105420|augustus-scaffold_2.g653 XP_003035059.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]