SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003055810.1.6386 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003055810.1.6386
Domain Number 1 Region: 113-224
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000497
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003055810.1.6386
Sequence length 289
Comment predicted protein [Micromonas pusilla CCMP1545]; AA=GCF_000151265.2; RF=representative genome; TAX=564608; STAX=38833; NAME=Micromonas pusilla CCMP1545; strain=CCMP1545; AL=Scaffold; RT=Minor
Sequence
MEHFTEDLACLVFTQVTNVRDRRALAAVNATFRRASRRVESLPVALDHNVPVTGTGNGPV
LRGDFEDLIAHVFDHDGAFDLPRERVMELVRLTVADTATLPLIIYEGTTPRTDKDNFDNF
CIHAAKAGRLDVLRWARENSDWGEWDSIVWQSAAIKGHLDILQWGEEIWPSSCSCPCAAA
ACGGQIETLKWLLQDRTCPCEDPEWRCASAARNGQLEALRWLREVHGDPWDENVFIQTLE
NQPEHGYGDNAKKNISDVLQYAFDNQCPGWTRYGGRWAFEPLRFIKNIE
Download sequence
Identical sequences C1MJC8
XP_003055810.1.6386 jgi|MicpuC3|50892|MicpuC2.EuGene.0000011116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]