SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003065050.1.1890 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003065050.1.1890
Domain Number 1 Region: 121-223
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.32e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003065050.1.1890
Sequence length 349
Comment 90S preribosome/SSU processome component KRR1 [Coccidioides posadasii C735 delta SOWgp]; AA=GCF_000151335.1; RF=representative genome; TAX=222929; STAX=199306; NAME=Coccidioides posadasii C735 delta SOWgp; strain=C735 delta SOWgp; AL=Scaffold; RT=Major
Sequence
MPSTHKKDKPWDTDDIDKWKIEEFKPEDNAGGTFAEESSFVSLFPKYREVYLKETWPIIT
RALEKHGIACTLDLVEGSMTVKTTRKTYDPAAILKARDLIKLLARSVPAPQALKILEDGT
ACDIIKIRNLVRNKERFVKRRQRILGPSGSTLKALELLTNTYLLVQGNTVAAMGPYKGLK
EVRRVVEDCMNNIHPIYHIKELMIKRELAKDPKLANESWDRFLPHFKKRTLSKRKKPFKV
TDKSKKVYTPFPPPQEKSKVDLQIESGEYFLSKDAKERARKEEIMERQREKRAEKMKEIE
KDFIPPKEDTGEKKKKKRKRQEDATDKAVDGEKKSKKRKSKEKVRTQEE
Download sequence
Identical sequences A0A0J6FF97 C5PJK6 E9DEX4
XP_003065050.1.1890 222929.C5PJK6 CPAT_05352 CPSG_08374T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]