SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003083372.1.19543 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003083372.1.19543
Domain Number 1 Region: 4-136
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-34
Family Calponin-homology domain, CH-domain 0.0000679
Further Details:      
 
Domain Number 2 Region: 205-263
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.000000000000183
Family EB1 dimerisation domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003083372.1.19543
Sequence length 363
Comment Microtubule-binding protein involved in cell cycle control (ISS) [Ostreococcus tauri]; AA=GCF_000214015.2; RF=representative genome; TAX=70448; STAX=70448; NAME=Ostreococcus tauri; strain=RCC4221; AL=Chromosome; RT=Major
Sequence
MASTTGMMAPAFFVGRSELVAWVNALLDVNISKVEQCASGAIYCQILDAAHRTSNVVPMR
RVNFEARSEHEFVANYKILQAVFEKLNIAKNIEVQKLVKARPLDNLEFLQWMKCYYDTAT
GGGCREECGSYDAEERRAGARGGASFARRPQATAAPRERRPAVRRDHHARETTTASTTSE
RGVEHVRHHSRAVDGANASSSARTRELTEANAALKLQVERAEQEREFYFEKLQDVEFVCQ
RPEFESNALKIVIERILYHTDGKADVEAIIAECFAEDTKTEALSATPTPPPTELPSPSPV
AVATASMATLRLERLDSGLSASPIGASPLGTPPPMFSPEESSATSEKATESPREPLRDAS
NAV
Download sequence
Identical sequences 70448.Q00UX9 XP_003083372.1.19543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]