SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003110496.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003110496.1.11157
Domain Number 1 Region: 391-581
Classification Level Classification E-value
Superfamily Fibronectin type III 3.55e-30
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 2 Region: 234-334
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-21
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 3 Region: 30-62,120-216
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.37e-18
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003110496.1.11157
Sequence length 614
Comment CRE-TWK-32 protein [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MCGGALLSSGLCRFSELTPGQFGLTKQLVFRLALPHITLLVVSILYAVFGGWMLTLIKYS
QQTTHQAIMFDQTRQSFAKKLAGIGDKADFETIVNELVEKTYEFYTMEDGHRWQEAAFNS
NPLTNFTSNLFFAATTLTSIGYGIDAPESLVGRVFCLVYLFFGIPLYLITIADMAKFCTE
LMNRTYTEIIKYKYRVKRRYKRWKSGRIRRESMKVGQVIIAGGEDEVAEFLWTHLEHAQF
VEVPFLLVIGILLLYIGLSSWIISWVENWNMTDGFYFVMMSVLTIGFGDLVPRNEIFAVP
ILFIILAGLVLTTTCVDVVGAYYIDRLHFFGRRLDDDPLSWLKEVQQRRIEAMKKEAMRK
LFETVTALHHIRLTAFKQLTQNYDDHLRSKAPDPPRHLVASHATADSVMLRWSAPIYVDE
GKRYWYTITYKPRTPQRRNNVVAVDFINKDRYLVTGLKSFTLYEFSVYVTTRYGQSVPIK
VQEYTEPCTVPQSVRIDAISDETATISWRAPKMNNGPESYIIQFVQEPAPQFVYWNKYRV
GSSTRFTLTDLHADTRYIICVTAEHNHGLAAMSKSMRFRTKKWWGDEDSTCLRIPGTSHR
LSIASAISTLTALR
Download sequence
Identical sequences E3M0E7
CRE05409 XP_003110496.1.11157 31234.CRE05409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]