SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003111906.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003111906.1.11157
Domain Number 1 Region: 407-591
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-26
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 11-44,116-186
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.15e-20
Family Voltage-gated potassium channels 0.0051
Further Details:      
 
Domain Number 3 Region: 229-344
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000785
Family Voltage-gated potassium channels 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003111906.1.11157
Sequence length 637
Comment CRE-TWK-30 protein [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MSCFQVESDKMARFLSLHVLLIGSVVLYIILGAIVFQMLEGEHLDTLKKEHMDRIDQNAK
DYVDRLWDLTKKEKDTFDNVDDLIKSVKAKTSDDFFDYVDTVFYAHRAVRHGYDEDSPTW
DFANSVFFTTTMLTSIGYGYVAPSTFGGRLFGVIYCLIDKPNSGIPLTLVTVANVAKFLS
ETIFFLHYELWNKCLEWKRKRKGEVEADPAQPMFGDDENEEEILDRVRLVRFPPLTVFMF
VFVYGCIAAWVVRYWETWTYVESLYFIFISILTVGFGDIRPSPGNIWVTLAFVVGKSTLK
NYSEEIIPVGVILTTMCMDVVGRMYLKEIHYLGRKLKSNNPFYLLREAKARRRRAAMASL
LAQLAKGMIFAHKDYNELARKKSKRKKEKRRGSHVLPNEKFMFARLPPDPPSDCQVVSTS
AYSVRLAWAPPFSPDPDLTYNIRYRLKHNEDAKVRELRGIKGNTVEIMSVDSCSLYEFRI
TAHNKFGESKAVYLVQYTEPQLSPQHILATRLNANTIELTWEPPYKKSHEVKNYVVYFTE
NPNASLSEWEKIPVNGRRVVFPDLRFDWFYMFSATAVFKDGQRSPLSRALFIKTDKIEFH
KHCVGHSKTIDVMDSICEKEENETTALLKRDYVSFAV
Download sequence
Identical sequences E3LVM4
31234.CRE29760 CRE29760 XP_003111906.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]