SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003113840.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003113840.1.11157
Domain Number 1 Region: 136-184
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.005
Further Details:      
 
Weak hits

Sequence:  XP_003113840.1.11157
Domain Number - Region: 270-316
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003113840.1.11157
Sequence length 970
Comment CRE-GLD-3 protein [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MGEQSKEGEADEPASFDPFVRSEVEYDSTTRLHMAEDVASTRRLFVSPALKDIIVNPENF
YHGCQQSAKMAEDANQRRQVSFNTKREAFIHQLRANGLPLPSKIPMIEINPTRVTLSLEF
EAQYYSLMTNDYGNHENVASIMQQTNTLIQFPDRSESSHDPFVQQITITGHYSDVDKARK
LMRDNCHVSIIMSLQDLKVSQSELQAFAEQNPIQNVDMFFLTSSSEKNGEALPHLRFTSR
TKNEHELIQAANMILKKAYGNELQRKHPLIEQRTNVRISYPGYNTKEDIRGNLFTITING
TVENVLEARKYLMDLLPVSICFNMANTDMAAQSELADRCIHVLIEESRIMFKMTPSVYEP
SELLSDEVPLHWASLRSKEFNIKHMYTAYQKVLAKKIEVVAPQPTDYDKSIWHRCLPQGF
LFFLLLCRGESSDSSASHRRHRSTSVTSSQSKQGFPKGKSSSDVPIVPTRSQPRVSSVSE
CISMYSPPICKNYVYCFIAQPYHPMQMFTDPITHSQLTQMIMMQQQQAHALMKGSPLLQP
VPFAYPIVFDQGTGAPICFPYHPIDPNFFQYPGIPISEGFDRSTNRQETSTSGHQTNSNK
KPTRMMNRPSSGGSHHYSSSTHRPRRGYEQIRDDDARSSTRSGSRRTSTSGDEPTVGSYE
DRGFDRQFSRHNQRYSKDDNMRWKTGSRGDINARRNQNFQKDFRPASTSRDYDFHVGSAG
STDRHASTDQLQFQSTHHLKLKPNEVDLDQERLFTHDSPQVDERAYPQSGFGSGLVDGDF
VQKFISNVNVNDPKKRSRAVSCFIERDDQIARLTDSDCAYSVTDQTITQPSRSIDSFKKL
PGAGVTKTMLEPRSRNEKEYAKINLEHKDKFTGEPIDEDKYTDMGPSFGSRQYRIDPMKL
IASVRESSEQLPRIHERQFNDVLNDKERELAASAFKERNMETNLVQERSLDDTSPLDYAF
RNDQSTDNIR
Download sequence
Identical sequences E3LQK3
31234.CRE26447 XP_003113840.1.11157 CRE26447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]