SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003114872.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003114872.1.11157
Domain Number 1 Region: 132-243
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.28e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003114872.1.11157
Sequence length 324
Comment hypothetical protein CRE_28190 [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MDPYQQGGRGGGYPSRGGRGGGGGGHMGYPPDQGNYGGAPAYGGYDPYNPYAQGGYGMYP
GGGSYPPQEMPSPLDAEIQAVLREIHSEVAGLESSGEQFRNARRLLNSEKEKLENNIDPE
WLEVDVAKPVKVCKKILIPIYRHPSFNFIGKVLGPKGATLQTLCKTHKCHIYILGRGSTK
DREKEAELLTSGDPQHAHFSGPLHVKVETVAPAYIAYGRVAAVIEELSRILQPIHEDTTP
AHLKNGTGGEGDEKNDDERKDDDGSGRGGRGGGRGGFRGGFRGGRGGGFGGGPRGSGGPG
GPMMGGRGGMGRGRGGQPAGFRPY
Download sequence
Identical sequences E3LMT5
XP_003114872.1.11157 31234.CRE28190 CRE28190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]