SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003124584.4.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003124584.4.46622
Domain Number 1 Region: 42-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-34
Family SCAN domain 0.0000938
Further Details:      
 
Domain Number 2 Region: 842-898
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 786-842
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 883-935
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 5 Region: 738-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000833
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  XP_003124584.4.46622
Domain Number - Region: 250-286
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0157
Family KRAB domain (Kruppel-associated box) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003124584.4.46622
Sequence length 969
Comment zinc finger protein with KRAB and SCAN domains 2 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MAASLDPQIHASLEAEGCLIMKVEKEPEWASEPILEGSDGSECETFRKCFRQFCYDDVTG
PHEAFSKLWELCCRWLKPEMRSKEQILELLVIEQFLTILPEKIQAWAQKQCPESGEEAVA
LVIHLEKENRRLRQQVSSPVHSEKQVPVGAAWEVADFEPEQVETQPRLMSQEEVERLHSG
HQEPLNQKRELRPLPKNAQPSPWVPAPADDWNTMAQEVTATQLPVGSQRPGKDIHMARGF
PYKKSVHQIPAHRDLCGDIRKESVGNMVSLGSTVTTSNKIPRVEQRKEPWTIGLHSSSKR
NILRSSYVKEKPVPALQVPARNAGKTWREQQQWGLEDEKIAGVHWSYEETKTFLAILKES
RFYETLQACPRNSQVYGAVAEWLRECGFLRTPEQCRTKFKSLQKSYRKVRNGHVLEPCAF
FEDMDALLNPTAHASSTDKPKEILSLPRLKRISISAKERINLVEEEDAAEESDGDEMGVE
FIRKSELHGAPVLFQNLSGVHWGYEETKTFLEILRETRFYEALQACHRKSKLYGAVAEQL
RECGFLRTPEQCRTKFKSLQKSYRKVKNGHVLESCAFYKEMDALINSRVPAPPAGTPEEV
PSPSFQEREDIEIEPQEPVGWEPEEASQEAVVEDSGSERMSEEEIVQEPEFLGPPGLLQS
PHDFEIGSSFNEDATQVIYKDLEQHRALIEKAKRVVSQNADPGKHHKRECISGRQWENLQ
GIRQGKPMAQPRDLGKAVVHQRPFLGKRPYRLLRYGEGFGRSARLLCRMPHQKENPYKCS
VCGKCFGRSRSLIRHQRIHTGEKPFKCLDCGKSFNDSSNFGAHQRIHTGEKPYRCGECGK
CFSQSSSLIIHQRTHTGEKPYQCGECGKSFTNSSHFSAHRRVHTGENPYKCADCEKSFNN
CTRFREHRRIHTGEKPYGCAQCGKRFSKSSVLAKHREVHTREKLLPHPPALYSPENPQKG
KTDQFRTSF
Download sequence
Identical sequences I3LP64
XP_003124584.4.46622 ENSSSCP00000025889 ENSSSCP00000008351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]