SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003124635.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003124635.1.46622
Domain Number 1 Region: 5-40
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000153
Family BAFF receptor-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003124635.1.46622
Sequence length 178
Comment tumor necrosis factor receptor superfamily member 17 isoform X1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MAQQCYQNEYFDRLLIACKPCRLRCSNTPPVTCQHYCNTMKGTNVILWTCLGLSLIVSLT
VFILMFLLRKRSSGPLRDELRNPGSVPQKGAGADLGNGSEGRMGAETLLSRGLEYTVEEC
TCEDCVQSEPKVDSDHFFPLPAMEEGATILVTTKTNGYCSSLLAAESALALEKSISTR
Download sequence
Identical sequences A0A287BN35
ENSSSCP00000008421 ENSSSCP00000008421 XP_003124635.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]