SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003127678.3.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003127678.3.46622
Domain Number 1 Region: 216-277
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000248
Family LIM domain 0.0071
Further Details:      
 
Domain Number 2 Region: 274-343
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000121
Family LIM domain 0.019
Further Details:      
 
Weak hits

Sequence:  XP_003127678.3.46622
Domain Number - Region: 185-214
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00113
Family LIM domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003127678.3.46622
Sequence length 378
Comment filamin-binding LIM protein 1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MASKPEKRVASSVFITLAPPRRDEAVVEEVKRAACEARPGCPRESPVPVKAPGAGSAGRL
RSWAPPGRASAPVPAVPPQLSNGGCSLPPPPLDGEDSLPDLDLLPPPPPPPPPMYLPPPD
QEPPASVGALVSDLEQLHLPPPPPPPQALVEGPPLQPQPSPLRPMEELPPPPEEPVSLPE
REASTDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRVCRRQLAGQSFYQKDGRPLCEPC
YQDTLEKCGKCGEGVREHIIRALGQAFHPTCFTCVTCARCIGDESFALDSQNEVYCLDDF
YRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLN
NRLFCKPCHVKRSAASCC
Download sequence
Identical sequences F1SUU4
XP_003127678.3.46622 XP_005656078.1.46622 XP_013844218.1.46622 XP_020951049.1.46622 ENSSSCP00000003763 ENSSSCP00000003763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]