SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003135101.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003135101.1.46622
Domain Number 1 Region: 255-306
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000288
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 2 Region: 135-184
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000484
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 74-130
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 187-247
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000549
Family TSP-1 type 1 repeat 0.00079
Further Details:      
 
Domain Number 5 Region: 309-369
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000116
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 6 Region: 380-413
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000275
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003135101.1.46622
Sequence length 463
Comment properdin isoform X1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MPTQRQAPQLLLLPLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSLEDCCLNADY
AFQETSSKFCMPCRPPQWSPWSAWAPCSVTCTEGSQLRHRRCVGWGGQCPENVELGTLQW
QLQACENQPCCPEMGGWSSWGPWAPCSATCSRGTRTRRRACDRPTPKCGGHCPGEAQESE
DCDTQQVCPTHGAWAAWGPWGPCQSTCKGGPSEPVERRKRTCTAPEPSTKPPGNPCSGSA
NDQRMCSGLPPCPVAGGWGPWGAVSPCPVTCGLGQTREQRSCDHPVPQHGGPFCVGEAFR
THICNTAVPCPVDGEWGLWGEWSNCVRRGIKHISCQEIPGQQTRSRICKGRKFDGRRCLG
EQQDIRHCYSIQRCPLKEASWSEWSTWGLCIPPCGPSPVRTRQRLCQPKLPNFPPTITPV
EGQGEKNVTFWGKPLVKCDVLQGQHMMVEEKRPCLHAPPCNEP
Download sequence
Identical sequences A0A0B8RZN8 F1RWV1
ENSSSCP00000029588 XP_003135101.1.46622 ENSSSCP00000030234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]