SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003201209.2.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003201209.2.45394
Domain Number 1 Region: 1090-1107,1144-1252
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000039
Family Synaptotagmin-like (S variant) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003201209.2.45394
Sequence length 1666
Comment coiled-coil and C2 domain-containing protein 2A isoform X5 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MSSPGDVREKIKKKRRELQESLGKVRDDKQALVPSDWDVSKENEHTAVEEMAGGKEDPGE
TLRHSLMARRMKKKKKLLKESAVECIADDEELTAVQDTRGADGQHARTPTELSPRDASPH
TVMRPGSSQSEKTMRQRMTEKLRAAKSKAASLLEQESSIEPVSRLQSLQDRNTVTRFDRD
MDPDLRADEDSSFAARLKFRDAARRAVKDKQVEAGLPTAEEAYNFFTFNFDPEPEQQRQK
KKRRSRRREAEEEEEGDSEGEVEGEDEEGEEVGELERQNEGEEESEARDEDDPLVGDEED
LFIIDQSAQDFLEVRRAEYVDYSRRLQRERDTLFVPSMRPVPASSKLAENTRPRFLEEEG
LYVGERPHVCLTNLNILENRILKQAEGRKWFGDDGRIVALPDPIKESSSRPPLFHLEDQL
DPALQTVYRKALKSKHVNLYIAGMGDHQADYQLDVDVSGLIFSHHPLFSREHVLGARLAQ
LYDQHLTRLHKNLTQLLTDKLNSLRNTIHNMLELHRGEALSQVSQQRIAEYKQEVRHTRQ
LRDVEQEKDRALLKNIIRLWKELKALRDFQRFTNTPYKLFIRREKVERLQDEQEFESDIM
AEVSELQAETEEEYQRKMNEYRRLHEEWKSWKRKQKALKKKQKKKRQEEEEEDEVSEEEL
GEEPEKPNPPEKPDTSILEEQVREKAARIRRNPGEPVLIPELTVSGSITANEQCPRAEFA
RREDVAKRSLFVKVLYNDKEVSRTDSRTLNMDFRVHFGQIFNLKIVNWPESIKLQVFESV
GSSSTQLTEVCVPVPESSVLTGSAPSEEMEFSSNQRVTFNHEGVGSGVPFSFEADGTNPQ
TLLTSGKLSCCVSWAVGEDDVPLAPPSAQPGVAMHSGLRQMDAIACIGASGLNDMKKLGK
WAAESRLDPNDPSNASIMQLLSVVSGGDMGVPEYFRLEQLQEEFNFLSEEELQRSRRYRL
LRLRSQEVQEFRHFKCVPSTDREISEKVFQDYENRLKEGEIIDTKEHIDAHRALVAKYLQ
RVRESVINRFLIAKHHFILSDVISEDEVPSIGVLGWNLFKLAEPKRPLKPRRKERKKVTA
QNLSEGDIKLLVNIIRGYDIPVRRPYTGKAPVSAKSGRSFTETFTAPASQTGQQGSEWPF
AQPLIRPFVEVSFQRSVLQTSTAEGPNPCWNEEIVLPFSAPNGDYSSTSLQSVRDEVFIN
VFDELLYDVVEDERERGNTIHTRIERHWLGSINIPFSTIYLQSRIDGTFKVCTPPVLLGY
SKERSLGSEGGYDAVRSPSEGTFLSLFITIEPQLVPGDTVREKFDSQEVERVLLASEVFE
KEASRRFSDRPCITTVIDINGKTVFVTRFIRPLNPPQELLDASPNGTQDSTELVARYVSL
IPSLPDSVSFAGVCDLWSTCDQFLTLLAGDEEEHAVLLCNYFLSMGKRAWLIIGSAIPEG
PTAYVLTYEQSRYVIWNASTGQHYGQYDVFCPLQTIGCLINADNVWFNIQPYAAPVRMSF
DISKPNLWKPFFSRAFPDPGLSSVQPDALVYRRTDRTAAVELQDRIEKVLREKLMEWRPR
HPTRWNRYCISTLRQFLPKLELSGGREVAEEHRLELQSLLGEYRISGFPLHLPFSELRPI
IEAVHSTGVHKVESPNVEFALAVYVHPYPSNVLSVWVYIASLVSAY
Download sequence
Identical sequences E7F3T4
ENSDARP00000107405 ENSDARP00000107405 XP_003201209.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]