SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003201409.4.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003201409.4.45394
Domain Number 1 Region: 220-300
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000628
Family Ypt/Rab-GAP domain of gyp1p 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003201409.4.45394
Sequence length 606
Comment TBC1 domain family member 24 isoform X2 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MRIQSQICPLPDRQSKANQLEQNGRLVPLILSSVQRVRSEVMAGDCGVFVDWSQMGDVSR
DAAPGKTEYKDLKELKQHARSGQWAKNHSQRSAVYQHLLKALPCRTVTPDAEVYRDIVGN
STSKRNPSAYPLPEFVDGTAVPQYCLKAESIGSVHAVISCVAGQFPDISHCPSLPAVTAL
MMHWSPDEAQCFESVSRMLACNEPGRRLLDQTFLAYESACMTFGDLVHKYCPAAHKLMVA
TATDVLEVYSDWQRWVFGDLPFSFAARVLDVFLVEGYKVLYRVALAILKFYRKQFVASNS
APSKQDSAAVRRDIQTFVQSIGKSVTPDKLLEKAFSIRLFSRKEITLLQLANEKSLQQKG
ITVKQKRQNVQLAVNADNFSSEIVSAKEIRDIWSWIPERFALCQPQLLFTTSTHGCSLNR
FYAHCEGYEPTLLLIRTTDREVCGAFLSTDWEERKRGGNKLSFFGTGECFVFRMKPEMER
YEWVIIKHPELAKSAQSAEDQSSVEDNGTPHSGETLEKPTTDSSHLSPFLSARHFNLNSR
NTSMFMAGNVDSIIIGGGDGNALYIDSELNHGRTERCLTFDNPPLCAESFQVALLEVWGF
KDAMGS
Download sequence
Identical sequences E7FCR8
XP_003201409.4.45394 ENSDARP00000106395 ENSDARP00000128484 ENSDARP00000106395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]