SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003218523.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003218523.1.98722
Domain Number 1 Region: 379-607
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.94e-28
Family RecA protein-like (ATPase-domain) 0.0084
Further Details:      
 
Domain Number 2 Region: 167-318
Classification Level Classification E-value
Superfamily DNA primase core 0.0000112
Family Primase fragment of primase-helicase protein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003218523.1.98722
Sequence length 666
Comment PREDICTED: twinkle protein, mitochondrial isoform X1 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MWLPVRSLHHWCLRGRRVLSGRHPCRHYKKETLPSPDGPVPPASVTEIRQYLRAQDIPFH
DGYSCIHVPSVFVEEQQQVRHSYTLFIDKTTGRFVCTATLVEGNWQDFQASVELQHKGVA
GGSLEDIDKPRDHTGEDARHIWERAMPLWELLDEQETQEAKAKFGISSISNATLKRFGVR
YLRTAQALVFPWFSPRGTSLKGLKLLGVERQGETANYVENTLPRPSAYHNLFGLPLIGRR
DTEVVLTGRELDTLALHQATGLPILALPRGISCLPPGLLPYLEQFKRITLWLGEDLRSWE
AAKLFARKLNPKRCSLVQPSDQQLQPLEAFTRGLNLTKILRSALPAGHKAIISFRQLREE
VLGELANVEQVAGVKWARFPELNKLLKGHRKGELTVFTGPTGSGKTTFISEYALDLCMQG
VNTLWGSFEINNVRLAKIMLTQFAMGRLEEQLDKFDEWADRFEDLPLYFMTFHGHQNIKT
VMDTMKHAVYMYDITHIIIDNLQFMMGQEQLTVDRLAVQDYIVGTFRKFATENSCHVTLV
IHPRKEDEERELQTASIFGSAKASQEADNVLILQDRKLVTGPGKRYLQISKNRFDGDVGI
FPLEFSKTSLTFSSPIKAKTAKLKKMKDDNGVPPKKAPTGGASKKQRSQSPNHTTPETSP
NEPVKT
Download sequence
Identical sequences G1KC80
XP_003218523.1.98722 ENSACAP00000003685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]