SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003220158.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003220158.1.98722
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.52e-69
Family BAR domain 0.00031
Further Details:      
 
Domain Number 2 Region: 245-276,311-368
Classification Level Classification E-value
Superfamily SH3-domain 8.33e-17
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003220158.1.98722
Sequence length 369
Comment PREDICTED: endophilin-B1 isoform X3 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKLWTEKVM
KQTEVLLQPNPNARMEEFVYEKLDRKAPSRVNNPELLGQHMIDAGNEFGPGTAYGNALIK
CGETQKRIGAADRELIQTAAINFLTPLRNFIEGDYKTITRERKLLQNKRLDLDAAKTRLR
KAKVAEARAASEQEVRIAQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSTFLANNNQSTTTCVPSSSNTTTAASSVSVTASLSSLSNVAAPS
SFGELKSSSGSRKARVLYDYDAANSTELSLLADEVITVYSIPGMDSDWLMGERGNQKGKV
PITYLELLN
Download sequence
Identical sequences G1K9U9
ENSACAP00000001683 XP_003220158.1.98722 ENSACAP00000001683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]