SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003224038.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003224038.1.98722
Domain Number 1 Region: 221-461
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-48
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 64-171
Classification Level Classification E-value
Superfamily POZ domain 4.71e-28
Family Tetramerization domain of potassium channels 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003224038.1.98722
Sequence length 509
Comment PREDICTED: potassium voltage-gated channel subfamily G member 1 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MTLLPGENSDYDYSALSCASDASFNHPFFAETETLKGVFYQRAKLIHPGEDLYECIHPED
RKHHIIINVGGFKYLLPWTTLDEFPMTRLGQLKFCNNFDDILNICDDYDVTCNEFFFDRN
PGAFRTILTFLRAGKLRLLREMCALSFQEELLYWGIEENSLEWCCKRKYLQKMEEFAELN
ETEDEFIDSENQSDAVVETKAGLCMKKLQDMVERPQSGIPGKVFACLSVIFVTITAVNLS
ISTMPGLREEEERGECSQMCYNIFIVESVCVGWFSLEFILRFIQAPSKFVFLRNPLTMID
IVAILPYYITLFLDTASLGSNKKPSSGNIYLDKVGLVLRILRALRILYVMRLARHSLGLQ
TLGLTARRCTREFGLLLLFLCVAIALFSPLLYVIENEMTGSQEFSSIPASYWWAVITMTT
VGYGDMVPRSIPGQVVALSSILSGILLMAFPVTSIFHTFSRSYIELKQEQERIMYRRAQF
LMKSKSELSHASQGSDVFPSASSETREHD
Download sequence
Identical sequences H9G896
ENSACAP00000003826 ENSACAP00000003826 XP_003224038.1.98722 XP_008113811.1.98722 28377.ENSACAP00000003826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]