SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003228575.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003228575.1.98722
Domain Number 1 Region: 28-260
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.85e-85
Family Calponin-homology domain, CH-domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 280-402
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-34
Family Spectrin repeat 0.000000618
Further Details:      
 
Domain Number 3 Region: 516-635
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-29
Family Spectrin repeat 0.00000554
Further Details:      
 
Domain Number 4 Region: 403-511
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-26
Family Spectrin repeat 0.0000036
Further Details:      
 
Domain Number 5 Region: 640-752
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-23
Family Spectrin repeat 0.00000263
Further Details:      
 
Domain Number 6 Region: 751-899
Classification Level Classification E-value
Superfamily EF-hand 3.35e-23
Family EF-hand modules in multidomain proteins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003228575.1.98722
Sequence length 905
Comment PREDICTED: alpha-actinin-4 isoform X3 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MVDYHAAGQPASYQYGGNGPGIGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRK
AGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKL
VSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQ
NFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDI
VNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLL
EWIQRTIPWLENRVPQKTMQGMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRL
SNRPAFMPSEGKMVSDINNGWQHLEQAEKGFEEWLLNEMRRLERLEHLGQKFRQKASIHE
SWTEGKEAMLKQKDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYY
DSPSVNARCQKICDQWDTLGSLTHTRREALEKTEKQLETIDQLHLEYAKRAAPFNNWMES
AMEDLQDMFIVHTIEEIEGLIAAHDQFKSTLPDADKEREAILGIQSEAQKIADYNNIKLS
GNNPYTSVTPQIINSKWERVQQLVPKRDHALQDEQSKQQSNEHLRRQFASQANIVGPWIQ
TKMEEIGRISIEMNGTLEDQLNHLKQYEQSIVDYKPNIDVLEQQHQLIQEALIFDNKHTN
YTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGSLG
PEEFKACLISLGYDVENDRQGDAEFNRIMSVVDPNNSGVVTFQAFIDFMSRETTDTDTAD
QVIASFKVLAGDKNYITAEELRRELPPDQAEYCIARMAPYQGPDAIPGALDYKSFSTALY
GESDL
Download sequence
Identical sequences XP_003228575.1.98722 28377.ENSACAP00000010147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]