SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003252260.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003252260.1.23891
Domain Number 1 Region: 20-141
Classification Level Classification E-value
Superfamily Lysozyme-like 7.19e-46
Family C-type lysozyme 0.000000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003252260.1.23891
Sequence length 142
Comment PREDICTED: alpha-lactalbumin [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MRFFVPLFLVGILFPAIPAKQFTKCELSQLLKDIDGYGGIALPELICTIFHTSGYDTQAI
VENSESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGI
DYWLAHKALCTEKLEQWLCEKL
Download sequence
Identical sequences G1S884
ENSNLEP00000021723 ENSNLEP00000021723 XP_003252260.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]