SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003253384.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003253384.1.23891
Domain Number 1 Region: 154-237
Classification Level Classification E-value
Superfamily Immunoglobulin 8.82e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 2 Region: 36-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000421
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003253384.1.23891
Sequence length 416
Comment PREDICTED: hepatocyte cell adhesion molecule [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MKRERGALSRASRALRLAPFVYLLLIQTDPLEGVNITSPVRLIHGTVGKSALLSVQYSST
SSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTY
EVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTW
LKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCVVENPISQGRSLPVKITVYRRSS
LYIILSTGGIFLLVTLVTVCACWKPSKRKQKKLEKQSSLEYMDQNDDRLKPEADTLPRSG
EQERKNPMALYILKDKDSPEPEENPAPEPRSATEPGPPGYSVSPAVPGRSPGLPIRSARR
YPRSPARSPATGRTHTSPPRAPSSPGRSRSASRTLRTAGVHIIREQDEAGPVEISA
Download sequence
Identical sequences G1R785
ENSNLEP00000009057 XP_003253384.1.23891 ENSNLEP00000009057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]