SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003253656.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003253656.1.23891
Domain Number 1 Region: 122-301
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.05e-49
Family CRAL/TRIO domain 0.0000387
Further Details:      
 
Domain Number 2 Region: 40-118
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 9.29e-21
Family CRAL/TRIO N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003253656.1.23891
Sequence length 342
Comment PREDICTED: alpha-tocopherol transfer protein-like isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MSEESDSLRTSPSVASLSENELPPPPEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQA
LRDMVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSA
LKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQV
NGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIK
PFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGMAGELDTATWNAVLLASEDDFVKE
FCQPVPACDSILGQTLLPEGLTSDAQCDDSLRAVKSQLYSCY
Download sequence
Identical sequences G1R4C0
ENSNLEP00000008042 ENSNLEP00000024281 ENSNLEP00000008042 XP_003253656.1.23891 XP_003253657.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]