SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003253691.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003253691.1.23891
Domain Number 1 Region: 34-71
Classification Level Classification E-value
Superfamily Elafin-like 0.00000222
Family Elafin-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003253691.1.23891
Sequence length 86
Comment PREDICTED: WAP four-disulfide core domain protein 6 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MGLSGLLPILVPFILLGDVQEPGHAEGIFGKPRPKIKVECKVEEIDQCTKPRDCPENMKC
CLFSRGKKCLDLRKVSLTLYHKEELE
Download sequence
Identical sequences G1R4T9
XP_003253691.1.23891 ENSNLEP00000008211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]